PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G316600.10.p
Common NameSb02g034560, SORBIDRAFT_02g034560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 783aa    MW: 89362.1 Da    PI: 6.7492
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G316600.10.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR170.15.2e-2254140290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++Y++++GFsvrk k+++   +++i +++++Cskeg + +e  +  +++ +r+ trt+Cka+++ + +++g+w v++++  HnH+l
  Sobic.002G316600.10.p  54 LYCDYGHRIGFSVRKGKQSYFIGTKNIRTKDYYCSKEGLKYDEPVT--EANFNRPDTRTNCKAMIRFRVDEKGRWTVIRFVPVHNHQL 139
                            7********************9*******************99988..9999***********************************9 PP

                   FAR1  90 a 90 
                            a
  Sobic.002G316600.10.p 140 A 140
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.2E-2054140IPR004330FAR1 DNA binding domain
PfamPF105512.8E-33261354IPR018289MULE transposase domain
PROSITE profilePS509669.186542578IPR007527Zinc finger, SWIM-type
PfamPF044345.7E-6544575IPR007527Zinc finger, SWIM-type
SMARTSM005757.6E-6553580IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MDCSQDSQEE SHQRRENGEE AEKAADYGNA LSRKEATEEL LGCVVHSEEE AYRLYCDYGH  60
RIGFSVRKGK QSYFIGTKNI RTKDYYCSKE GLKYDEPVTE ANFNRPDTRT NCKAMIRFRV  120
DEKGRWTVIR FVPVHNHQLA KPGERHMLRS AKSLAVGKSG VIDPSASTES HPINGFSDMT  180
GDIAENSGYT IRECYNQVCM QNITIIEAGD SQSLVSYFKR RTNEEGMFYW DVQVDQEGRM  240
TNFFYRDGKS RNDYGCFGDA IIFDTTYRTN KYNLICAPFV GVDHHWQNVV FGCAFLLDES  300
VTSYAWVFKS FLESMGGRSP KSIFTDQDEA IMQAVEQVFP NTQHCFSYWH IVKNAQSHLG  360
SLNTSQAFQS MFTKCMQGSD SEEDFKESWT AMIQEYKLQD NSWLIDLYAF HRKWCSAFNK  420
DTFDGGINSS QWGEVSSNIF NGISDENTSL TRFALLLEKV VKDLRRNESE EDFRCSQTAP  480
VRAIKHSTVL KQAAESYTHR IYKLFEAEFL DGCGATSCHE TSSGGNLLRF GITMQGRGSK  540
VWDVVLDTST MEISCGCRKF ERMGLLCSHA LKVFTLQNVD TIPEKYVLKR WTKDARRSMY  600
TLAQDDSTQQ ECTEAELAYR NRAMQYAYNL IIKSQELEES RKIFWDSLET GEKALEVFFE  660
MRNMRTQAAK DANKNEKKKK KTSKGPNPKK AKQAPGVSST DLELIVQTNE HQFQSSQDAQ  720
GNATIGRPYY YQVPQTFPNA PIQPNQMYMH PNMHTVPLCT PQQDLSAFAI RPNSTFGGAK  780
NI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1685692PNPKKAKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.128150.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462925.10.0hypothetical protein SORBIDRAFT_02g034560
TrEMBLC5X9Z70.0C5X9Z7_SORBI; Putative uncharacterized protein Sb02g034560
STRINGSb02g034560.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-100FAR1-related sequence 5